PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C000260P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7108.28 Da    PI: 10.5325
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C000260P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF103.11e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey++
  MELO3C000260P1  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN 59
                    79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.824161IPR002100Transcription factor, MADS-box
SMARTSM004329.4E-42160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-30260IPR002100Transcription factor, MADS-box
CDDcd002653.62E-39260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-34323IPR002100Transcription factor, MADS-box
PfamPF003197.9E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYANN  60
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-22159159Myocyte-specific enhancer factor 2B
1tqe_R5e-22159159Myocyte-specific enhancer factor 2B
1tqe_Q5e-22159159Myocyte-specific enhancer factor 2B
1tqe_P5e-22159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6847572e-99LN684757.1 Cucumis melo genomic scaffold, unassembled_sequence32319.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146364.19e-38hypothetical protein PHAVU_006G034400g
SwissprotQ407042e-38MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLB9ETY53e-38B9ETY5_ORYSJ; Uncharacterized protein
TrEMBLA2WLS96e-38A2WLS9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002178-PA2e-37(Oryza sativa Indica Group)
STRINGOB01G16550.13e-36(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.22e-39MIKC_MADS family protein